(data stored in ACNUC7421 zone)

EMBL: CP000251.PE318

CP000251.PE318       Location/Qualifiers
FT   CDS             complement(371948..372721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0320"
FT                   /product="BioH protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80096"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80096.1"
FT                   /translation="MSPCHTMTASDGPLLTLLLPGLDGTGRLLERFVAAASGTLELRTL
FT                   SYPPDRVRSYAELAELVRAELPRGRRFALLGESFGGPLALRVAAGRPPGLVGVVLAASF
FT                   HRRPAARLVSALRPLSPAFFRLPLPAHAVRVLLAGHDAPDALVADVQAAVASVQPRVMA
FT                   RRAHEALHVDATGWLRDCPAPVLFLGGRQDRLLRTGLAIEIRLVRPDAEIRMLDAPHLV
FT                   LQRRPDEAMRAVEGFLARSPAATAPLRAASADEPA"
     MSPCHTMTAS DGPLLTLLLP GLDGTGRLLE RFVAAASGTL ELRTLSYPPD RVRSYAELAE        60
     LVRAELPRGR RFALLGESFG GPLALRVAAG RPPGLVGVVL AASFHRRPAA RLVSALRPLS       120
     PAFFRLPLPA HAVRVLLAGH DAPDALVADV QAAVASVQPR VMARRAHEAL HVDATGWLRD       180
     CPAPVLFLGG RQDRLLRTGL AIEIRLVRPD AEIRMLDAPH LVLQRRPDEA MRAVEGFLAR       240
     SPAATAPLRA ASADEPA                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page