(data stored in ACNUC7421 zone)

EMBL: CP000251.PE319

CP000251.PE319       Location/Qualifiers
FT   CDS             372915..373748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80097"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80097.1"
FT                   /translation="MIGWISALALAAAVALVGVRRARFAREVAAEARSLWAVREDAPPS
FT                   RLDPGTLPEPVRRYLGLAGALGAAPLTAARLRHGGTFRPALEGAWRPIRGVQYLAAEPP
FT                   GFVWWGRVRLAPGLEVAARDRSAGGEGGMRIALASALVVADVTGPEIDAAALQRLLGEL
FT                   VWLPTALLDARHVAWLPRDASSARARLRVGGREVEATFHFGGDGLPERITALRYRDVKG
FT                   RGVLTPWTGRCADWREVGGVRVPFRMEASWELDGRDRPYARFELERLEHGVPRPF"
     MIGWISALAL AAAVALVGVR RARFAREVAA EARSLWAVRE DAPPSRLDPG TLPEPVRRYL        60
     GLAGALGAAP LTAARLRHGG TFRPALEGAW RPIRGVQYLA AEPPGFVWWG RVRLAPGLEV       120
     AARDRSAGGE GGMRIALASA LVVADVTGPE IDAAALQRLL GELVWLPTAL LDARHVAWLP       180
     RDASSARARL RVGGREVEAT FHFGGDGLPE RITALRYRDV KGRGVLTPWT GRCADWREVG       240
     GVRVPFRMEA SWELDGRDRP YARFELERLE HGVPRPF                                277
//

If you have problems or comments...

PBIL Back to PBIL home page