(data stored in ACNUC7421 zone)

EMBL: CP000251.PE325

CP000251.PE325       Location/Qualifiers
FT   CDS             385200..385688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0327"
FT                   /product="protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80103"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80103.1"
FT                   /translation="MPFRPNARSRASRALEWTFAALLLGASAAILVAAGVSRADAHYQW
FT                   TRPAGDPARGAVTPAAVWERLRTVLDPELGIDVVDLGLVYDVTVPRDGRVAVVMTLTSA
FT                   GCPFSKQMIEDVRRAIFQHPAVREVALTVTRDPPWSWDRVSLEARKRIVEGSHAGAHR"
     MPFRPNARSR ASRALEWTFA ALLLGASAAI LVAAGVSRAD AHYQWTRPAG DPARGAVTPA        60
     AVWERLRTVL DPELGIDVVD LGLVYDVTVP RDGRVAVVMT LTSAGCPFSK QMIEDVRRAI       120
     FQHPAVREVA LTVTRDPPWS WDRVSLEARK RIVEGSHAGA HR                          162
//

If you have problems or comments...

PBIL Back to PBIL home page