(data stored in ACNUC7421 zone)

EMBL: CP000251.PE326

CP000251.PE326       Location/Qualifiers
FT   CDS             385685..386311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80104"
FT                   /db_xref="GOA:Q2IMS0"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80104.1"
FT                   /translation="MTLLGPLSSGFLLGLGTGPLCFIGCIPLALPFALPEAGAGPRRGA
FT                   WGFLAKFLAGRLVAYSTVGVLTGLASSMAGPVQRRVVTVAWLALSVVLIVHGLGRGLPH
FT                   RGACGAVARVARSRAFPFLLGLAAALSVCPPFLLAVAYAMDRSGQVVGGLAFFLAFFAA
FT                   TTLYVVPVALLGYLPRRDLWQRVGRGASVIAGIALLVQGVRELLA"
     MTLLGPLSSG FLLGLGTGPL CFIGCIPLAL PFALPEAGAG PRRGAWGFLA KFLAGRLVAY        60
     STVGVLTGLA SSMAGPVQRR VVTVAWLALS VVLIVHGLGR GLPHRGACGA VARVARSRAF       120
     PFLLGLAAAL SVCPPFLLAV AYAMDRSGQV VGGLAFFLAF FAATTLYVVP VALLGYLPRR       180
     DLWQRVGRGA SVIAGIALLV QGVRELLA                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page