(data stored in ACNUC7421 zone)

EMBL: CP000251.PE327

CP000251.PE327       Location/Qualifiers
FT   CDS             386435..388357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0329"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80105"
FT                   /db_xref="GOA:Q2IMS3"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80105.1"
FT                   /translation="MTKTDRYVLWGIGAAWVLDLAVFILSDYHIYAFLLLFVVAAVGLA
FT                   WWGLRFPVTAKLRRNAALSVSGFWTVALVLLFGPWPVPDKPDYIVGEVHRFSEMEHGFA
FT                   RGLTGVTGPNIAAGGLVYGDPADQGHMMSEWGWPPNFISGNPVSRALFGGTILMERLRG
FT                   ATTIGGEPANPLRYSWSNFEGEKRDKKLGWNSGDYLFGEVAKVMGTQKASYTPRENALM
FT                   IKSLAAWLGSPKIAIAAVDPRWFYSHDLSTWGTPLPLKDAKDLKYVIQLFTDQDWTRVH
FT                   NDSGTSWWSVSNSGQAYSTSAWIGIRMAQVLRDMGYTARVGFGGMNYENIETTVSVYSG
FT                   IGEYGRLSDAVVPTAGGLRFKSATIFTDFPMDVGEPNVGWGITRMCANCDRCARACPVN
FT                   AVPMGEPTVENGVNMWQVDKDKCTRFRTGNLNGNMCGACLAVCPYNKPDTPFHRVGNYI
FT                   IRHSPIATYLFGNIHGVGLEDWLDFEYSSEAGPYNVSRPARWIQEDPGWKAKFPYQVGQ
FT                   YIYTERDRSKNEEWASGVDPKMGKVGLSYKGTTWGKIPDRLVDANGRNRNVHWDYEAGE
FT                   LPPNLPLPGKLLTPEEATRLLLEGKAFSGASYTPDAEVFPPRDPKYEKQKLSYEQAARM
FT                   WAEEK"
     MTKTDRYVLW GIGAAWVLDL AVFILSDYHI YAFLLLFVVA AVGLAWWGLR FPVTAKLRRN        60
     AALSVSGFWT VALVLLFGPW PVPDKPDYIV GEVHRFSEME HGFARGLTGV TGPNIAAGGL       120
     VYGDPADQGH MMSEWGWPPN FISGNPVSRA LFGGTILMER LRGATTIGGE PANPLRYSWS       180
     NFEGEKRDKK LGWNSGDYLF GEVAKVMGTQ KASYTPRENA LMIKSLAAWL GSPKIAIAAV       240
     DPRWFYSHDL STWGTPLPLK DAKDLKYVIQ LFTDQDWTRV HNDSGTSWWS VSNSGQAYST       300
     SAWIGIRMAQ VLRDMGYTAR VGFGGMNYEN IETTVSVYSG IGEYGRLSDA VVPTAGGLRF       360
     KSATIFTDFP MDVGEPNVGW GITRMCANCD RCARACPVNA VPMGEPTVEN GVNMWQVDKD       420
     KCTRFRTGNL NGNMCGACLA VCPYNKPDTP FHRVGNYIIR HSPIATYLFG NIHGVGLEDW       480
     LDFEYSSEAG PYNVSRPARW IQEDPGWKAK FPYQVGQYIY TERDRSKNEE WASGVDPKMG       540
     KVGLSYKGTT WGKIPDRLVD ANGRNRNVHW DYEAGELPPN LPLPGKLLTP EEATRLLLEG       600
     KAFSGASYTP DAEVFPPRDP KYEKQKLSYE QAARMWAEEK                             640
//

If you have problems or comments...

PBIL Back to PBIL home page