(data stored in ACNUC7421 zone)

EMBL: CP000251.PE329

CP000251.PE329       Location/Qualifiers
FT   CDS             388678..390153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0331"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80107"
FT                   /db_xref="GOA:Q2IMS5"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80107.1"
FT                   /translation="MRWKARELGCVALAAAGAVAWAAMASAALVEREWRATWISVGAAL
FT                   ACAAVATGLVVARRRGALDGAVPRRVLRAALASAVALALALVLPSDRSFPDKRVGAATP
FT                   TTEYDASTQPGNDVLGKVERTRGGGSEDELTFTVYDVCSGKVAHRAARDGAPAPVAVEV
FT                   TEPAVLAAQIKDEARALGAQVTGITALHPQFVFRKDNDGRPVELRHRFAIVIGTGLDYR
FT                   LASPSAPLPWRDYYSAIPEEVAAVLSGRSDDPAVPIPAEVIQEYRDTLEFYAEGGRIAV
FT                   HLAKAIRSLGYPARAHFGRWSEVQVVPLAIEAGLGEVGKNGMLINDRFGPRGSFAVVTT
FT                   DIPLAVDRQRDLGVQEFCRVCNKCADACPVNAVPRGDAGAPAGGVSRWQVDGPKCWTYL
FT                   KLNPKCMACTGACPFNKKDLLAHRWAQALIARKSVVANHLLVWLDDLLGYGRAALRLRD
FT                   EARRALGEPAAAPPQAPDRPQAGGGASAPEARS"
     MRWKARELGC VALAAAGAVA WAAMASAALV EREWRATWIS VGAALACAAV ATGLVVARRR        60
     GALDGAVPRR VLRAALASAV ALALALVLPS DRSFPDKRVG AATPTTEYDA STQPGNDVLG       120
     KVERTRGGGS EDELTFTVYD VCSGKVAHRA ARDGAPAPVA VEVTEPAVLA AQIKDEARAL       180
     GAQVTGITAL HPQFVFRKDN DGRPVELRHR FAIVIGTGLD YRLASPSAPL PWRDYYSAIP       240
     EEVAAVLSGR SDDPAVPIPA EVIQEYRDTL EFYAEGGRIA VHLAKAIRSL GYPARAHFGR       300
     WSEVQVVPLA IEAGLGEVGK NGMLINDRFG PRGSFAVVTT DIPLAVDRQR DLGVQEFCRV       360
     CNKCADACPV NAVPRGDAGA PAGGVSRWQV DGPKCWTYLK LNPKCMACTG ACPFNKKDLL       420
     AHRWAQALIA RKSVVANHLL VWLDDLLGYG RAALRLRDEA RRALGEPAAA PPQAPDRPQA       480
     GGGASAPEAR S                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page