(data stored in ACNUC7421 zone)

EMBL: CP000251.PE330

CP000251.PE330       Location/Qualifiers
FT   CDS             390475..391929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80108"
FT                   /db_xref="GOA:Q2IMS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80108.1"
FT                   /translation="MTWAGPAALAVFVGGVVASLRGWIPQRVITLQALLLAIAGIALGL
FT                   TALAGQPIPWPQLLASANVHPVTSVIAGFLLAGALHAAGAFDAAARLLARLTRTRLGAP
FT                   FVILLVVNLPTILAMPCGRILVSPLMPLALMLGWALARERREPVLVAVTVFGLVVNAAA
FT                   SCGPSVIGGIGMLGEGMGRYPPGSFSNPAQIAILVITVATMALIRWGFGGTLRMRATPP
FT                   APVERPVPEHGYLALAMFVAVLLLVVLVRPPVPLQVTLTLGTACVMLVARLGLDDLLGG
FT                   VMLHPLSAMLAGFLVAGALSVAGAFDALLVLLVWAAEHTWLGYVGVSVVLAYVPVMLAM
FT                   PCGRIVSLALIPGVLLFGVRLAGVTGLERATPTLLSAFILAGAASCGPSAIGGIGSIGE
FT                   GRLRIRDAWSGQPQALGIFLGVPVTALLVSRLPLASVALDVRYFPVALALGALAGAVVN
FT                   LVYGYRVHHLGGLLGGLVTGALLVIL"
     MTWAGPAALA VFVGGVVASL RGWIPQRVIT LQALLLAIAG IALGLTALAG QPIPWPQLLA        60
     SANVHPVTSV IAGFLLAGAL HAAGAFDAAA RLLARLTRTR LGAPFVILLV VNLPTILAMP       120
     CGRILVSPLM PLALMLGWAL ARERREPVLV AVTVFGLVVN AAASCGPSVI GGIGMLGEGM       180
     GRYPPGSFSN PAQIAILVIT VATMALIRWG FGGTLRMRAT PPAPVERPVP EHGYLALAMF       240
     VAVLLLVVLV RPPVPLQVTL TLGTACVMLV ARLGLDDLLG GVMLHPLSAM LAGFLVAGAL       300
     SVAGAFDALL VLLVWAAEHT WLGYVGVSVV LAYVPVMLAM PCGRIVSLAL IPGVLLFGVR       360
     LAGVTGLERA TPTLLSAFIL AGAASCGPSA IGGIGSIGEG RLRIRDAWSG QPQALGIFLG       420
     VPVTALLVSR LPLASVALDV RYFPVALALG ALAGAVVNLV YGYRVHHLGG LLGGLVTGAL       480
     LVIL                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page