(data stored in ACNUC7421 zone)

EMBL: CP000251.PE331

CP000251.PE331       Location/Qualifiers
FT   CDS             391926..392417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80109"
FT                   /db_xref="GOA:Q2IMS9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80109.1"
FT                   /translation="MRRALVAVNALAVGLTLAYLGWLLGDALRAGQPWAVTCYDCKACT
FT                   ARCVLGLDPQGFVSAALAGSGDVYMYATNVRLRARHALEIDPGMLVTVGDRHPTAREAA
FT                   AELGPDAEVVTFRMRARDAARACFRCGACEKGCGLRLPLLRVITQLRGDASNEWASHAP
FT                   "
     MRRALVAVNA LAVGLTLAYL GWLLGDALRA GQPWAVTCYD CKACTARCVL GLDPQGFVSA        60
     ALAGSGDVYM YATNVRLRAR HALEIDPGML VTVGDRHPTA REAAAELGPD AEVVTFRMRA       120
     RDAARACFRC GACEKGCGLR LPLLRVITQL RGDASNEWAS HAP                         163
//

If you have problems or comments...

PBIL Back to PBIL home page