(data stored in ACNUC7421 zone)

EMBL: CP000251.PE339

CP000251.PE339       Location/Qualifiers
FT   CDS             400512..401399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80117"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80117.1"
FT                   /translation="MKPHPWKPILALLAAITLATPAAAKEGGDQYPVGVDGLAAGALPP
FT                   PGTYLLSMVALVHGDVQDADGHDAGVEANAQFGVLRLVHVTKLRVLGAQYAFGAILPYW
FT                   HQSAKIRTPAGKLELDADGPGDITLNPVYLNWHLPRNLHLLATVDLNLPTGRFRTDGGL
FT                   SQGVGYYSVSPAVAATWYAPGGFEASGKLLYNLKRENPVTGVRSGDELELDFAVAKLFG
FT                   PFEAGIGGYYAVQTTDDELDGQKVNAKAEGLALGLQAAYQAPFGTFIGMWHHDVTSDSR
FT                   LQADRVFLKFMLPL"
     MKPHPWKPIL ALLAAITLAT PAAAKEGGDQ YPVGVDGLAA GALPPPGTYL LSMVALVHGD        60
     VQDADGHDAG VEANAQFGVL RLVHVTKLRV LGAQYAFGAI LPYWHQSAKI RTPAGKLELD       120
     ADGPGDITLN PVYLNWHLPR NLHLLATVDL NLPTGRFRTD GGLSQGVGYY SVSPAVAATW       180
     YAPGGFEASG KLLYNLKREN PVTGVRSGDE LELDFAVAKL FGPFEAGIGG YYAVQTTDDE       240
     LDGQKVNAKA EGLALGLQAA YQAPFGTFIG MWHHDVTSDS RLQADRVFLK FMLPL            295
//

If you have problems or comments...

PBIL Back to PBIL home page