(data stored in ACNUC7421 zone)

EMBL: CP000251.PE342

CP000251.PE342       Location/Qualifiers
FT   CDS             complement(403933..404667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80120"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80120.1"
FT                   /translation="MSPGARKGAAGAAQREDVGEAEVVREYGPFDGAPVHGVSFDGERV
FT                   WAATGARLVAFDPASGEPVRTLEVACDAGTAFDGRHLYQLAGDRILRVDPTTGAVLGSI
FT                   PAPEGAGGSGLCWAEGSLWLGRYGERRILRLDPATGAVLRTIESDRFVTGVTWVDGELW
FT                   HGTMEAGESELRRVDPDGGAVRARLAMPRGVLVSGLESDGAGLFFCGGAASGKVRAVRR
FT                   PGPAGRTASRARRAGPRGPRRR"
     MSPGARKGAA GAAQREDVGE AEVVREYGPF DGAPVHGVSF DGERVWAATG ARLVAFDPAS        60
     GEPVRTLEVA CDAGTAFDGR HLYQLAGDRI LRVDPTTGAV LGSIPAPEGA GGSGLCWAEG       120
     SLWLGRYGER RILRLDPATG AVLRTIESDR FVTGVTWVDG ELWHGTMEAG ESELRRVDPD       180
     GGAVRARLAM PRGVLVSGLE SDGAGLFFCG GAASGKVRAV RRPGPAGRTA SRARRAGPRG       240
     PRRR                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page