(data stored in ACNUC7421 zone)

EMBL: CP000251.PE349

CP000251.PE349       Location/Qualifiers
FT   CDS             complement(410420..411406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80127"
FT                   /db_xref="GOA:Q2IMU5"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80127.1"
FT                   /translation="MERPTSEPRTPPARSIASFLVPALGLACVALPHVSPALALTAGVA
FT                   LALSTGNPYAPTTRALARRLLPLSVVALGGAMDLRVVAHVGARGVGYTFVSIAACLALG
FT                   ALLARAARVEARTAALISVGTAICGGSAIAAVAPVVGADEHETSIALGAVFLLNSAALL
FT                   VFPLLGHAAGLGEPAFGLWAALGIHDTSSVVGATLAYGPQALAVGTTVKLARALWIVPV
FT                   TLAIGIVARRARGGGAATSARPPWFILGFVAVAALATFLPALRPAGLLAAEAGRRALVL
FT                   TLFLVGLGLSRQALRSVGAGALAMAVALWIAVGTATLAAVRTGLVHL"
     MERPTSEPRT PPARSIASFL VPALGLACVA LPHVSPALAL TAGVALALST GNPYAPTTRA        60
     LARRLLPLSV VALGGAMDLR VVAHVGARGV GYTFVSIAAC LALGALLARA ARVEARTAAL       120
     ISVGTAICGG SAIAAVAPVV GADEHETSIA LGAVFLLNSA ALLVFPLLGH AAGLGEPAFG       180
     LWAALGIHDT SSVVGATLAY GPQALAVGTT VKLARALWIV PVTLAIGIVA RRARGGGAAT       240
     SARPPWFILG FVAVAALATF LPALRPAGLL AAEAGRRALV LTLFLVGLGL SRQALRSVGA       300
     GALAMAVALW IAVGTATLAA VRTGLVHL                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page