(data stored in ACNUC7421 zone)

EMBL: CP000251.PE35

CP000251.PE35        Location/Qualifiers
FT   CDS             44718..45995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79813"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79813.1"
FT                   /translation="MRRIHLALAVLATLAALPPARAQPAPAAPPAPQAPAPAAPAPAPA
FT                   AKPPGVTVDLSGWLIANAYWSDGGLNASDLPQWATTAHSTAGMTVRQSRVRAALGLPVD
FT                   GLLGGAVLKGLVEADFMGTYVNSDASMPQVRLRHAYLTAACARGNLTLLVGQTWSLFGG
FT                   PWFAASLGHVALPRFAGAGYLYRRAPQVRLTAEAGRGRDVGVTAAVAALASSGDKATSQ
FT                   NQLVGERAGVPDAEGRLALVLRRAGKAWLEVGASGRFGQQLWKLDGLSTPREERLTGWG
FT                   VAADGRLEVPHLVVQGGTFMGEVLGGYGSVAPVVRPTKDATDATKLDAISPVRTGGFWA
FT                   QAVVTPIPVLQLLGGYGIEEPRTSDLPAGAEATTIERNQQVSGGAILALTSRWKVSLEG
FT                   TLYTTETLDGARRESTQVEVGSLYAF"
     MRRIHLALAV LATLAALPPA RAQPAPAAPP APQAPAPAAP APAPAAKPPG VTVDLSGWLI        60
     ANAYWSDGGL NASDLPQWAT TAHSTAGMTV RQSRVRAALG LPVDGLLGGA VLKGLVEADF       120
     MGTYVNSDAS MPQVRLRHAY LTAACARGNL TLLVGQTWSL FGGPWFAASL GHVALPRFAG       180
     AGYLYRRAPQ VRLTAEAGRG RDVGVTAAVA ALASSGDKAT SQNQLVGERA GVPDAEGRLA       240
     LVLRRAGKAW LEVGASGRFG QQLWKLDGLS TPREERLTGW GVAADGRLEV PHLVVQGGTF       300
     MGEVLGGYGS VAPVVRPTKD ATDATKLDAI SPVRTGGFWA QAVVTPIPVL QLLGGYGIEE       360
     PRTSDLPAGA EATTIERNQQ VSGGAILALT SRWKVSLEGT LYTTETLDGA RRESTQVEVG       420
     SLYAF                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page