(data stored in ACNUC7421 zone)

EMBL: CP000251.PE37

CP000251.PE37        Location/Qualifiers
FT   CDS             complement(47456..47899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0037"
FT                   /product="ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79815"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79815.1"
FT                   /translation="MKIRQLSLFLENRPGQLRVPCQVLGDAGIDILTLSLADTQQFGIL
FT                   RLIVKDHTRARQVLEQAGVVVNVTDVLAVDVPDRPGGLAEVLQGFEACGLGIEYMYAYS
FT                   VRSRGEHATLVFRLSDPDRAAALLQARGVRLVGAAELFARAGA"
     MKIRQLSLFL ENRPGQLRVP CQVLGDAGID ILTLSLADTQ QFGILRLIVK DHTRARQVLE        60
     QAGVVVNVTD VLAVDVPDRP GGLAEVLQGF EACGLGIEYM YAYSVRSRGE HATLVFRLSD       120
     PDRAAALLQA RGVRLVGAAE LFARAGA                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page