(data stored in ACNUC7421 zone)

EMBL: CP000251.PE370

CP000251.PE370       Location/Qualifiers
FT   CDS             complement(434890..436056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80148"
FT                   /db_xref="GOA:Q2IMX0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80148.1"
FT                   /translation="MLSILANRALERDGLGPIRDKVLAGERLGDADGLRLFEAADLPAL
FT                   GALANHVREARHGALAFYNRNVHLNPTNVCVASCKFCSFARKDDQRASDGYTMSLDEAV
FT                   AKVLSRKPLGVTEVHIVSGLHPDLPFEYYTELLSRIRAAWPEVAIKAFTAIEIHFFAEK
FT                   FGMSYEQVLRRLMDAGLQTMPGGGAEIFAPRVRRKICDDKATADQWIEIHRTAHRLGVK
FT                   TNSTMLYGHIERLDERVDHMRRLRALQDETHGFQVFIPLAFHPEHNMIGKAFPKPTGYD
FT                   ALRTLAVARLYLDNFDHVKAYWVSLGERLAQTALSFGVDDLDGTVLEERIYHMAGSTVP
FT                   QALSERTLHQLIRAAGRVPAERDSLYRVLKVHDAPLPAEPPARLQVTA"
     MLSILANRAL ERDGLGPIRD KVLAGERLGD ADGLRLFEAA DLPALGALAN HVREARHGAL        60
     AFYNRNVHLN PTNVCVASCK FCSFARKDDQ RASDGYTMSL DEAVAKVLSR KPLGVTEVHI       120
     VSGLHPDLPF EYYTELLSRI RAAWPEVAIK AFTAIEIHFF AEKFGMSYEQ VLRRLMDAGL       180
     QTMPGGGAEI FAPRVRRKIC DDKATADQWI EIHRTAHRLG VKTNSTMLYG HIERLDERVD       240
     HMRRLRALQD ETHGFQVFIP LAFHPEHNMI GKAFPKPTGY DALRTLAVAR LYLDNFDHVK       300
     AYWVSLGERL AQTALSFGVD DLDGTVLEER IYHMAGSTVP QALSERTLHQ LIRAAGRVPA       360
     ERDSLYRVLK VHDAPLPAEP PARLQVTA                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page