(data stored in ACNUC7421 zone)

EMBL: CP000251.PE374

CP000251.PE374       Location/Qualifiers
FT   CDS             439013..439288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80152"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80152.1"
FT                   /translation="MERRNRARDLIVLALAELDGELSTNQHRLCPEQLGTCRSRLQGYL
FT                   SALDGDALPPKRERAEDLGRLILDSWPYDVPLGQVILRAERAWRNA"
     MERRNRARDL IVLALAELDG ELSTNQHRLC PEQLGTCRSR LQGYLSALDG DALPPKRERA        60
     EDLGRLILDS WPYDVPLGQV ILRAERAWRN A                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page