(data stored in ACNUC7421 zone)

EMBL: CP000251.PE375

CP000251.PE375       Location/Qualifiers
FT   CDS             complement(439352..442216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0377"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80153"
FT                   /db_xref="GOA:Q2IMX5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80153.1"
FT                   /translation="MPSFALKSPVAVARAAIAPTLRPAPPGDCASRPPVHTCHSMRARF
FT                   AALAPLLLASCAFGRPRLSTPACATGAEALPSGIQLVAYALPHRPDTLVAASYRVGSAR
FT                   DPAGKEGLAHLVEHLSFRARHGGGRALSARLEAEGVEFDGRTSADATDFHAVGDPDQLD
FT                   ALLRIEADRLRDPLAGVDEAELRREREVVLQELALRGDPDALGSQVDWLTARALAGHPY
FT                   GRIATPESLRAITLEDVRAFARAHYRPENLLLLVAGPAPAGAVAARARAALGELATRPG
FT                   EPADPPVAPPELRASRPAALDVVRAPVERAWLLLTVPLPGDAAAGGARAYLALRALEAQ
FT                   VEQVLSGPDRDRALSVELLVHGMDGASLPVIRIGLRDPDDARPLVERLRAGLRFAGWQG
FT                   GPDPGAEELRDRLVLDAHVRLEAFDASEVARWIRLTGRTDYLTGMPAAVGAAVTPDRAA
FT                   FARRWLREERLVALAVVPGEAPRDEAPPRLAGASALDDDDPHGAAAAGEPAPARDAARA
FT                   MRPPHLDSARRRRLKNGVRVIVSPRPGYRVLSAHLVVRTAPAGPLERVFEVLALRAARC
FT                   ADRPATVGGDRLEFGARAPTELVDLALAQVACRAGDLAVDAAAFERERDAMADALRRRP
FT                   PTLHETAGQQLLELLYPGHPYSAEVTEARVRAFRAADAGKWLGLNVRPERAALVIAGDV
FT                   EATDALFERIEQRLGRWRPRGGDGTLPARPPAPLPGRRELVVVDRPGWRVAEVLVGVRV
FT                   PPRGARDEAAFRTLSWRLQHVLTARLREGEGLTYRVSLSMLEQSLGSALVLSTAVDRAR
FT                   AGEALAAVLAELAASARPLDPEALARARWRAVRRAGRALGTSWRNALRLTEMFVHGLPP
FT                   DEWDTFAARAAALDARALVAEAGRWALGREAIVVVGDAAVIAPALEAAGLPARVLPAIA
FT                   RRPPAETAAVGSAAAEPGPRASAP"
     MPSFALKSPV AVARAAIAPT LRPAPPGDCA SRPPVHTCHS MRARFAALAP LLLASCAFGR        60
     PRLSTPACAT GAEALPSGIQ LVAYALPHRP DTLVAASYRV GSARDPAGKE GLAHLVEHLS       120
     FRARHGGGRA LSARLEAEGV EFDGRTSADA TDFHAVGDPD QLDALLRIEA DRLRDPLAGV       180
     DEAELRRERE VVLQELALRG DPDALGSQVD WLTARALAGH PYGRIATPES LRAITLEDVR       240
     AFARAHYRPE NLLLLVAGPA PAGAVAARAR AALGELATRP GEPADPPVAP PELRASRPAA       300
     LDVVRAPVER AWLLLTVPLP GDAAAGGARA YLALRALEAQ VEQVLSGPDR DRALSVELLV       360
     HGMDGASLPV IRIGLRDPDD ARPLVERLRA GLRFAGWQGG PDPGAEELRD RLVLDAHVRL       420
     EAFDASEVAR WIRLTGRTDY LTGMPAAVGA AVTPDRAAFA RRWLREERLV ALAVVPGEAP       480
     RDEAPPRLAG ASALDDDDPH GAAAAGEPAP ARDAARAMRP PHLDSARRRR LKNGVRVIVS       540
     PRPGYRVLSA HLVVRTAPAG PLERVFEVLA LRAARCADRP ATVGGDRLEF GARAPTELVD       600
     LALAQVACRA GDLAVDAAAF ERERDAMADA LRRRPPTLHE TAGQQLLELL YPGHPYSAEV       660
     TEARVRAFRA ADAGKWLGLN VRPERAALVI AGDVEATDAL FERIEQRLGR WRPRGGDGTL       720
     PARPPAPLPG RRELVVVDRP GWRVAEVLVG VRVPPRGARD EAAFRTLSWR LQHVLTARLR       780
     EGEGLTYRVS LSMLEQSLGS ALVLSTAVDR ARAGEALAAV LAELAASARP LDPEALARAR       840
     WRAVRRAGRA LGTSWRNALR LTEMFVHGLP PDEWDTFAAR AAALDARALV AEAGRWALGR       900
     EAIVVVGDAA VIAPALEAAG LPARVLPAIA RRPPAETAAV GSAAAEPGPR ASAP             954
//

If you have problems or comments...

PBIL Back to PBIL home page