(data stored in ACNUC7421 zone)

EMBL: CP000251.PE378

CP000251.PE378       Location/Qualifiers
FT   CDS             complement(444986..446059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80156"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80156.1"
FT                   /translation="MAAAERFEAALPGGAFAPDPVPDDGPFSDGGAFFASRNVTPPAAF
FT                   RASTPAGAGGWLTVESYTRRAGASTRDLAEVVPDPADPANHALRITSRAHTDATVLRPS
FT                   APLPARYRISVRVGFPSFGDGVAGGLNGYDGPADAGPWWPGEDATRQNGFYWLTILDRL
FT                   PRPHVNTWIHHHRKVVVDSDNHYPPWMEIWDGGRFVWSGEHPVMLFALDGTQPGAERTG
FT                   PPFLSYSDGAWQPSGAIRAVDAYLPDTWYRVTIERDGPRYTVEVSGRFRYGGEQTYRAT
FT                   IDAAAACVFHYPVDAAEAAGAARCVDEGAFASVGPAYPRWPAGGVWPDWFMLGDPHVNY
FT                   YEGSVLYDDLVLETWRD"
     MAAAERFEAA LPGGAFAPDP VPDDGPFSDG GAFFASRNVT PPAAFRASTP AGAGGWLTVE        60
     SYTRRAGAST RDLAEVVPDP ADPANHALRI TSRAHTDATV LRPSAPLPAR YRISVRVGFP       120
     SFGDGVAGGL NGYDGPADAG PWWPGEDATR QNGFYWLTIL DRLPRPHVNT WIHHHRKVVV       180
     DSDNHYPPWM EIWDGGRFVW SGEHPVMLFA LDGTQPGAER TGPPFLSYSD GAWQPSGAIR       240
     AVDAYLPDTW YRVTIERDGP RYTVEVSGRF RYGGEQTYRA TIDAAAACVF HYPVDAAEAA       300
     GAARCVDEGA FASVGPAYPR WPAGGVWPDW FMLGDPHVNY YEGSVLYDDL VLETWRD          357
//

If you have problems or comments...

PBIL Back to PBIL home page