(data stored in ACNUC7421 zone)

EMBL: CP000251.PE381

CP000251.PE381       Location/Qualifiers
FT   CDS             448416..448859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0383"
FT                   /product="Hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80159"
FT                   /db_xref="GOA:Q2IMX9"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80159.1"
FT                   /translation="MRFVDPTQIPELPLPFMNDDHAEEVRLLEALGEALEAHRARTGGL
FT                   DVVLERLSLLAVHTREHFLREEQVMRESGFPAYPQHKGEHDRVLAEMDGEARAFREGGD
FT                   PVRLHAYLFETVPAWFVQHIRTMDAMTARFVVSRPGAPGAAAV"
     MRFVDPTQIP ELPLPFMNDD HAEEVRLLEA LGEALEAHRA RTGGLDVVLE RLSLLAVHTR        60
     EHFLREEQVM RESGFPAYPQ HKGEHDRVLA EMDGEARAFR EGGDPVRLHA YLFETVPAWF       120
     VQHIRTMDAM TARFVVSRPG APGAAAV                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page