(data stored in ACNUC7421 zone)

EMBL: CP000251.PE382

CP000251.PE382       Location/Qualifiers
FT   CDS             complement(448867..449700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80160"
FT                   /db_xref="GOA:Q2IMX8"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80160.1"
FT                   /translation="MRPLGHAALAALVALAAACGGRAARTPPLAIDPPAFRPEALLPTG
FT                   ADAYGVALALSGRIENPNPVALPVAGFTYAFEVMGAPAGGGQVASELVLPAGGAVPVTV
FT                   PVRLRWADVPGFLEALATRPSLPVTVSGAARVRAGGGTVAVPYRMDGSVVLPRLPSVTL
FT                   ADAVVRESTLFHTVVELRVSVRNPNPFPLPTGRLSYDLSVSGVPVIQAAKSALDAVPPQ
FT                   GQATVVVPVRFSTVGAAAGALAGAVRGRADLSVSGRAGYGALEVGVDLRGALAAR"
     MRPLGHAALA ALVALAAACG GRAARTPPLA IDPPAFRPEA LLPTGADAYG VALALSGRIE        60
     NPNPVALPVA GFTYAFEVMG APAGGGQVAS ELVLPAGGAV PVTVPVRLRW ADVPGFLEAL       120
     ATRPSLPVTV SGAARVRAGG GTVAVPYRMD GSVVLPRLPS VTLADAVVRE STLFHTVVEL       180
     RVSVRNPNPF PLPTGRLSYD LSVSGVPVIQ AAKSALDAVP PQGQATVVVP VRFSTVGAAA       240
     GALAGAVRGR ADLSVSGRAG YGALEVGVDL RGALAAR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page