(data stored in ACNUC7421 zone)

EMBL: CP000251.PE385

CP000251.PE385       Location/Qualifiers
FT   CDS             454238..455347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0387"
FT                   /product="chalcone/stilbene synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80163"
FT                   /db_xref="GOA:Q2IMY3"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80163.1"
FT                   /translation="MGLVRAEAAVPSTIPHPEVLSVGRALPPNAADQETLIAALSAHWG
FT                   EAHHNTGRLADLHRATGVARRHLALPLDAYARLGGFGEANAAYARAGAELGEAAVRDAL
FT                   ARAGLAPADVAHLFYVTVTGVATPSLDARLVNRLALPRSVKRTPIFGLGCLAGAAGLAR
FT                   ASDALRAFPDEVAVLLSVELCSLTLQRDDTSMANVIATGLFGDGAAAVVLGGGARPASA
FT                   PRRGPAVVATASVLYPDTEWVMGWEVVDGGFKVLLSSKVPEVIAANLGADVDRFLGAHG
FT                   LDRGSIRHWVAHTGGPKVLEAVGGALGLPRAALERSWRSLHDLGNLSSASVLFVLGDLL
FT                   ESGEARPGDLGLLAAMGPGFAAELVLLRW"
     MGLVRAEAAV PSTIPHPEVL SVGRALPPNA ADQETLIAAL SAHWGEAHHN TGRLADLHRA        60
     TGVARRHLAL PLDAYARLGG FGEANAAYAR AGAELGEAAV RDALARAGLA PADVAHLFYV       120
     TVTGVATPSL DARLVNRLAL PRSVKRTPIF GLGCLAGAAG LARASDALRA FPDEVAVLLS       180
     VELCSLTLQR DDTSMANVIA TGLFGDGAAA VVLGGGARPA SAPRRGPAVV ATASVLYPDT       240
     EWVMGWEVVD GGFKVLLSSK VPEVIAANLG ADVDRFLGAH GLDRGSIRHW VAHTGGPKVL       300
     EAVGGALGLP RAALERSWRS LHDLGNLSSA SVLFVLGDLL ESGEARPGDL GLLAAMGPGF       360
     AAELVLLRW                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page