(data stored in ACNUC7421 zone)

EMBL: CP000251.PE397

CP000251.PE397       Location/Qualifiers
FT   CDS             466201..466998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0399"
FT                   /product="ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80175"
FT                   /db_xref="GOA:Q2IMZ2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80175.1"
FT                   /translation="MPRTLRAIPTLLKVGFAEAVAYRAEMVVWLLSTNMPLVMLALWTA
FT                   VARDAPVGRFGQRDFVAYYLATLVVRLLTGAWVIWELNYEIRQGTLAFRLLRPVHPLLA
FT                   YAAENLSALPVRMLVSLPIALGALLVVGRDRLTGDPLLLALFPVTVLGAWLITFLAMAI
FT                   IGALAFWIDQAGSLFEIWLGLFGVFSGYLVPLELFPHWVATAARFLPFRYMLAFPVEMI
FT                   IGMTPRPVALAELAVQWTFVVALALGARGAWALGLRRFAAFGG"
     MPRTLRAIPT LLKVGFAEAV AYRAEMVVWL LSTNMPLVML ALWTAVARDA PVGRFGQRDF        60
     VAYYLATLVV RLLTGAWVIW ELNYEIRQGT LAFRLLRPVH PLLAYAAENL SALPVRMLVS       120
     LPIALGALLV VGRDRLTGDP LLLALFPVTV LGAWLITFLA MAIIGALAFW IDQAGSLFEI       180
     WLGLFGVFSG YLVPLELFPH WVATAARFLP FRYMLAFPVE MIIGMTPRPV ALAELAVQWT       240
     FVVALALGAR GAWALGLRRF AAFGG                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page