(data stored in ACNUC7421 zone)

EMBL: CP000251.PE40

CP000251.PE40        Location/Qualifiers
FT   CDS             complement(49738..51378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0040"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79818"
FT                   /db_xref="GOA:Q2ILY7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79818.1"
FT                   /translation="MERRLLSGDEAVAAAARDAGVRLGTGYPGTPSTEILQALDALGGR
FT                   AQWAPNEKVALEVGLGAAFGGARALVTMKHVGLNVAADPLFTAAYTGVKGGLVVVSADD
FT                   PGMASSQNEQDNRHYAVAAGLPMLEPADSQEAYDLTVAAFELSERFAIPVILRMTTRVC
FT                   HSKTLAARRADLPAPPAPAFVRDIPGRVMIPAYARPAHRRLRKKLEALQAFAEETPLNV
FT                   WVKGDRALGVITSGVTARHVAEAAPSASRLELKTVYPLPLEKIRAFAASVDRCVVVEEG
FT                   DPVFADAIRAAGIAVESKEAPYRFGELDVQRVRRILARDPSPEPELPKGRPPALCEACP
FT                   YHPVYATLRKLDCIVAGDIGCYTLGVLPPYQGIDTCVAMGASLGVGLGLRHVLPEADAR
FT                   RVVSIIGDSTFIHTGLNGLVEMVYNPPPTGHVLVVLDNGTTAMTGQQEHPGTGRTLDHE
FT                   PTGKVSIEGLARALGVANVDVIDPVADPAGWEELLKERLAEPKLSVIIARRPCILAAAD
FT                   IRRYEKAADEKRAALACAGCAGAGEVSDA"
     MERRLLSGDE AVAAAARDAG VRLGTGYPGT PSTEILQALD ALGGRAQWAP NEKVALEVGL        60
     GAAFGGARAL VTMKHVGLNV AADPLFTAAY TGVKGGLVVV SADDPGMASS QNEQDNRHYA       120
     VAAGLPMLEP ADSQEAYDLT VAAFELSERF AIPVILRMTT RVCHSKTLAA RRADLPAPPA       180
     PAFVRDIPGR VMIPAYARPA HRRLRKKLEA LQAFAEETPL NVWVKGDRAL GVITSGVTAR       240
     HVAEAAPSAS RLELKTVYPL PLEKIRAFAA SVDRCVVVEE GDPVFADAIR AAGIAVESKE       300
     APYRFGELDV QRVRRILARD PSPEPELPKG RPPALCEACP YHPVYATLRK LDCIVAGDIG       360
     CYTLGVLPPY QGIDTCVAMG ASLGVGLGLR HVLPEADARR VVSIIGDSTF IHTGLNGLVE       420
     MVYNPPPTGH VLVVLDNGTT AMTGQQEHPG TGRTLDHEPT GKVSIEGLAR ALGVANVDVI       480
     DPVADPAGWE ELLKERLAEP KLSVIIARRP CILAAADIRR YEKAADEKRA ALACAGCAGA       540
     GEVSDA                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page