(data stored in ACNUC7421 zone)

EMBL: CP000251.PE400

CP000251.PE400       Location/Qualifiers
FT   CDS             469122..469826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0402"
FT                   /product="Pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80178"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IMZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80178.1"
FT                   /translation="MITVRKTEARGHFDHGWLDTRHTFSFADYHDEAHMGFRALRVVNE
FT                   DRVKPGEGFGTHGHRDMEILSYVLGGTLAHRDSTGGGGRLRPGEVQRMSAGTGVMHSEY
FT                   NGSDREEVHFLQIWLIPDRQGLKPSYEQREYPEAERRGKLRLVAAPDGAGGATTLHADA
FT                   RVYATLLAAGERVALPLAPGRHAWVQVARGEATVNGERLRAGDGAALSGEAEVALAGAG
FT                   EGTAEVLVFDLA"
     MITVRKTEAR GHFDHGWLDT RHTFSFADYH DEAHMGFRAL RVVNEDRVKP GEGFGTHGHR        60
     DMEILSYVLG GTLAHRDSTG GGGRLRPGEV QRMSAGTGVM HSEYNGSDRE EVHFLQIWLI       120
     PDRQGLKPSY EQREYPEAER RGKLRLVAAP DGAGGATTLH ADARVYATLL AAGERVALPL       180
     APGRHAWVQV ARGEATVNGE RLRAGDGAAL SGEAEVALAG AGEGTAEVLV FDLA             234
//

If you have problems or comments...

PBIL Back to PBIL home page