(data stored in ACNUC7421 zone)

EMBL: CP000251.PE408

CP000251.PE408       Location/Qualifiers
FT   CDS             480509..481411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0410"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80186"
FT                   /db_xref="GOA:Q2IN08"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80186.1"
FT                   /translation="MKLRHVLPLIIGFVFVPAALMLTVGILILVYGSVARDYLFGILIV
FT                   SLVGTTIIGSAATLAVLFREARVAKLQTDFVNKVSHELRTPLTSIRMFVETLQLGRLQD
FT                   PQRQREALEIVAEETARLSGLINRLLDWARMESGRRVYELSRQPLGPILDAALAAFEPQ
FT                   QLHHPVQLELDLPSRLPSVMADRSALVEAVLNLLNNAFKYTGAEKRIRLSAVASGPTVT
FT                   IAVTDNGPGIPQRDQKHVFDKFYRASDPLKRTVEGTGLGLAMVKHIVIGHGGKVSVESE
FT                   PGRGATFVIALPVAGGTHG"
     MKLRHVLPLI IGFVFVPAAL MLTVGILILV YGSVARDYLF GILIVSLVGT TIIGSAATLA        60
     VLFREARVAK LQTDFVNKVS HELRTPLTSI RMFVETLQLG RLQDPQRQRE ALEIVAEETA       120
     RLSGLINRLL DWARMESGRR VYELSRQPLG PILDAALAAF EPQQLHHPVQ LELDLPSRLP       180
     SVMADRSALV EAVLNLLNNA FKYTGAEKRI RLSAVASGPT VTIAVTDNGP GIPQRDQKHV       240
     FDKFYRASDP LKRTVEGTGL GLAMVKHIVI GHGGKVSVES EPGRGATFVI ALPVAGGTHG       300
//

If you have problems or comments...

PBIL Back to PBIL home page