(data stored in ACNUC7421 zone)

EMBL: CP000251.PE426

CP000251.PE426       Location/Qualifiers
FT   CDS             complement(507601..508872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0428"
FT                   /product="putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80204"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80204.1"
FT                   /translation="MRSHDARAAAMGGTGHAGGVIHVPAVADEPSPAPADLASLTQAQR
FT                   AERALAEGRREREIPIERAFLQAALDFRQTLRVLVSAVVPKFADWCFVDLIDGDGIPRR
FT                   VEVAHGDPAKAPLAQEMRSIAFGPGWATPGAQTIRDRAPRLFRQVTTEVMEWATHGERH
FT                   LAVLRAIKPNSLLSVPLVARDRVIGSITLIRSNMLPGLDEADMVFAEALAEPAALALDN
FT                   ARWYQAEKAGRGAALEEADRERHDRVEAQRGVLRLRRIESVSASLASVLAPQAIARVAV
FT                   ENGLSVLEPATAMVVRAAPGASVLEVLHCQGWADDLTIDLRELRADAPALLAEAYRIQT
FT                   AIWVSSPEALAHSYPNAAELALRVGDRAWAAVPLRCDGRTVGALGLGFPHPRDLDADEK
FT                   RFVLTVAQIVAQALERARLRDEAR"
     MRSHDARAAA MGGTGHAGGV IHVPAVADEP SPAPADLASL TQAQRAERAL AEGRREREIP        60
     IERAFLQAAL DFRQTLRVLV SAVVPKFADW CFVDLIDGDG IPRRVEVAHG DPAKAPLAQE       120
     MRSIAFGPGW ATPGAQTIRD RAPRLFRQVT TEVMEWATHG ERHLAVLRAI KPNSLLSVPL       180
     VARDRVIGSI TLIRSNMLPG LDEADMVFAE ALAEPAALAL DNARWYQAEK AGRGAALEEA       240
     DRERHDRVEA QRGVLRLRRI ESVSASLASV LAPQAIARVA VENGLSVLEP ATAMVVRAAP       300
     GASVLEVLHC QGWADDLTID LRELRADAPA LLAEAYRIQT AIWVSSPEAL AHSYPNAAEL       360
     ALRVGDRAWA AVPLRCDGRT VGALGLGFPH PRDLDADEKR FVLTVAQIVA QALERARLRD       420
     EAR                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page