(data stored in ACNUC7421 zone)

EMBL: CP000251.PE432

CP000251.PE432       Location/Qualifiers
FT   CDS             complement(518184..519470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0434"
FT                   /product="Exodeoxyribonuclease I subunit D"
FT                   /EC_number="3.1.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80210"
FT                   /db_xref="GOA:Q2IN32"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80210.1"
FT                   /translation="MSDRRVSSMASVALRILHTADWHLGHALHGVDRGPEHERFVAWLL
FT                   DTAEAEAVDAVIVAGDVFDAANPPAGAQALWYRFLAEAWRRLPRLQLVVVGGNHDSASR
FT                   LDAVDPLLREMGRLHVVGGVPRGGAGAPDLEKLLVPLEDAAGRRAAWVAAVPYLRAADL
FT                   GAGAADADAAEATRRFYAAALERARARRAPGEALLATGHLYAVGGKTSELSERRLAVGN
FT                   QAAVPADAFPADLAYVALGHLHLAQAVGGRETVRYSGSALPLSFGERGYRHGVVVADLD
FT                   GEAVRAQRVLRVPRFVELVSVPDGEAPAPLPEVLAALEALPARGEGPDALRPLLEVKVR
FT                   LERPEPALRALLDQALAGKEARLVRIATTLAGTGRALGDGERRALGDLVPEDVFRRKYD
FT                   ADYGGPPPDALLEAFRALLQEVESEEGAR"
     MSDRRVSSMA SVALRILHTA DWHLGHALHG VDRGPEHERF VAWLLDTAEA EAVDAVIVAG        60
     DVFDAANPPA GAQALWYRFL AEAWRRLPRL QLVVVGGNHD SASRLDAVDP LLREMGRLHV       120
     VGGVPRGGAG APDLEKLLVP LEDAAGRRAA WVAAVPYLRA ADLGAGAADA DAAEATRRFY       180
     AAALERARAR RAPGEALLAT GHLYAVGGKT SELSERRLAV GNQAAVPADA FPADLAYVAL       240
     GHLHLAQAVG GRETVRYSGS ALPLSFGERG YRHGVVVADL DGEAVRAQRV LRVPRFVELV       300
     SVPDGEAPAP LPEVLAALEA LPARGEGPDA LRPLLEVKVR LERPEPALRA LLDQALAGKE       360
     ARLVRIATTL AGTGRALGDG ERRALGDLVP EDVFRRKYDA DYGGPPPDAL LEAFRALLQE       420
     VESEEGAR                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page