(data stored in ACNUC7421 zone)

EMBL: CP000251.PE437

CP000251.PE437       Location/Qualifiers
FT   CDS             522320..522604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80215"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80215.1"
FT                   /translation="MSLRRSDRFLAALAVAAALGAAALADARARRSAARPAAEEQARLV
FT                   ARLGLTDPCLFNDARYTRHLSQADRFAPFQDHPRALEHFPSGSLTAGAR"
     MSLRRSDRFL AALAVAAALG AAALADARAR RSAARPAAEE QARLVARLGL TDPCLFNDAR        60
     YTRHLSQADR FAPFQDHPRA LEHFPSGSLT AGAR                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page