(data stored in ACNUC7421 zone)

EMBL: CP000251.PE438

CP000251.PE438       Location/Qualifiers
FT   CDS             522601..523749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0440"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80216"
FT                   /db_xref="GOA:Q2IN35"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80216.1"
FT                   /translation="MTLRGALERQRSLLDFALGALGRRRGKTAALVAVHALLVFALASV
FT                   LLFTGGLREQVRAALRGAPDVVVQRMAAGRHEQVPAGWVETLGTLRGVSGARGRLWGYY
FT                   FEPVSGANLTVMVPDGGWASPGGAVAGPGVARVLGLKQGDRLPLRTYDGEALDLGVAAI
FT                   ASPAVELVASDLLLVSESDYRALFGAEPGRFTDVAVAVPNPDEVTRLAEKIVRMFPDAR
FT                   VVTRAEMIRTYDAVLDWRSGLAAAVLAGAVLAFAILAWDRASGLSAEERHELGILKALG
FT                   WDTRDVLAAKAWEGAAVSVSAFAIGALAAYAHVFLGGAVLLRPILEGWAALYPDLRPAP
FT                   PVQPLALATLLFLTVIPYVAATVVPCWRAATVDPDALMRGDA"
     MTLRGALERQ RSLLDFALGA LGRRRGKTAA LVAVHALLVF ALASVLLFTG GLREQVRAAL        60
     RGAPDVVVQR MAAGRHEQVP AGWVETLGTL RGVSGARGRL WGYYFEPVSG ANLTVMVPDG       120
     GWASPGGAVA GPGVARVLGL KQGDRLPLRT YDGEALDLGV AAIASPAVEL VASDLLLVSE       180
     SDYRALFGAE PGRFTDVAVA VPNPDEVTRL AEKIVRMFPD ARVVTRAEMI RTYDAVLDWR       240
     SGLAAAVLAG AVLAFAILAW DRASGLSAEE RHELGILKAL GWDTRDVLAA KAWEGAAVSV       300
     SAFAIGALAA YAHVFLGGAV LLRPILEGWA ALYPDLRPAP PVQPLALATL LFLTVIPYVA       360
     ATVVPCWRAA TVDPDALMRG DA                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page