(data stored in ACNUC7421 zone)

EMBL: CP000251.PE441

CP000251.PE441       Location/Qualifiers
FT   CDS             complement(526334..526864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0443"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80219"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80219.1"
FT                   /translation="MTQHVKAAIEGLAAAVTAEPHRARATFRATTISEGAGLATRSVVR
FT                   GFEVPLDEPRELGGTDTGPNPVEAVLAALGSCQAIVYRALAAAQGLQLERVEVVATGVL
FT                   DVRGFLGAAPVSPGFERVTFRTRLTSPEPLERLRALARQVEAQCPVLDVLQRPLDVRGE
FT                   LELVSIPAAGRAA"
     MTQHVKAAIE GLAAAVTAEP HRARATFRAT TISEGAGLAT RSVVRGFEVP LDEPRELGGT        60
     DTGPNPVEAV LAALGSCQAI VYRALAAAQG LQLERVEVVA TGVLDVRGFL GAAPVSPGFE       120
     RVTFRTRLTS PEPLERLRAL ARQVEAQCPV LDVLQRPLDV RGELELVSIP AAGRAA           176
//

If you have problems or comments...

PBIL Back to PBIL home page