(data stored in ACNUC7421 zone)

EMBL: CP000251.PE443

CP000251.PE443       Location/Qualifiers
FT   CDS             complement(528038..528577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80221"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80221.1"
FT                   /translation="MTAQEAGPRDAGPISRFLSDDHLRLHGLLARAVADPAAIDRGPYD
FT                   AFRGGLLRHIALEEKVLLPAAREAQGGEPLPLARRLRVEHGAIASLLVPTPTHALVAEI
FT                   RKILDPHNLLEEAPDGLYATCDGLLAARADELVARMAAYPAVKVAAYNDGPRVLRTAEA
FT                   ALEQSAKQAEARSGPR"
     MTAQEAGPRD AGPISRFLSD DHLRLHGLLA RAVADPAAID RGPYDAFRGG LLRHIALEEK        60
     VLLPAAREAQ GGEPLPLARR LRVEHGAIAS LLVPTPTHAL VAEIRKILDP HNLLEEAPDG       120
     LYATCDGLLA ARADELVARM AAYPAVKVAA YNDGPRVLRT AEAALEQSAK QAEARSGPR        179
//

If you have problems or comments...

PBIL Back to PBIL home page