(data stored in ACNUC7421 zone)

EMBL: CP000251.PE447

CP000251.PE447       Location/Qualifiers
FT   CDS             complement(530605..531312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80225"
FT                   /db_xref="GOA:Q2IN42"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80225.1"
FT                   /translation="MWEAVAITFRESFQRLAVNAARLVPGLLATLVFALLSLALAWACA
FT                   RLVRRILKAVQLDRLLRRWAPAEDRARLPSLVTYATRFAFWLVFAIGLALSLTSVESRW
FT                   TSALAERVLAYAPSVIVAGVLFAAAVALSRWVEASVLVSAVNMQIRSARLLATGARWLV
FT                   TVLGGAMALQHLGVGGALVTISFSILFGGIVLALALAVGLGSREVVTRSWERRLRDRDE
FT                   AHHDEEPPRIAHL"
     MWEAVAITFR ESFQRLAVNA ARLVPGLLAT LVFALLSLAL AWACARLVRR ILKAVQLDRL        60
     LRRWAPAEDR ARLPSLVTYA TRFAFWLVFA IGLALSLTSV ESRWTSALAE RVLAYAPSVI       120
     VAGVLFAAAV ALSRWVEASV LVSAVNMQIR SARLLATGAR WLVTVLGGAM ALQHLGVGGA       180
     LVTISFSILF GGIVLALALA VGLGSREVVT RSWERRLRDR DEAHHDEEPP RIAHL            235
//

If you have problems or comments...

PBIL Back to PBIL home page