(data stored in ACNUC7421 zone)

EMBL: CP000251.PE455

CP000251.PE455       Location/Qualifiers
FT   CDS             541082..541933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0457"
FT                   /product="ABC phosphonate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80233"
FT                   /db_xref="GOA:Q2IN52"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR030836"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80233.1"
FT                   /translation="MHRLAALAVAAVLLLPPAARALDALRVSAIPDESPTELQRKFEPL
FT                   GKYLGKQIGIPVKFVPVTDYAATVEGLAAGKLDMVWYGGFTFVQARRRTGNAIPLVQRA
FT                   EDARFHSKFIVPASSKAQSLKDLKGASFAFGSVSSTSGHLMPRYFLLQAGIDPDKDFAK
FT                   VAYSGAHDVTAKWVEAGKVDAGVVNESIWQRLVDEKKIDTSKVRVLWTTPEYQDYNWTV
FT                   RGDLDPKLVEKLRAAFLALDPAKPEDKAILDLQRASRFIPTSPDAYKNIEQAAKSAGLI
FT                   KD"
     MHRLAALAVA AVLLLPPAAR ALDALRVSAI PDESPTELQR KFEPLGKYLG KQIGIPVKFV        60
     PVTDYAATVE GLAAGKLDMV WYGGFTFVQA RRRTGNAIPL VQRAEDARFH SKFIVPASSK       120
     AQSLKDLKGA SFAFGSVSST SGHLMPRYFL LQAGIDPDKD FAKVAYSGAH DVTAKWVEAG       180
     KVDAGVVNES IWQRLVDEKK IDTSKVRVLW TTPEYQDYNW TVRGDLDPKL VEKLRAAFLA       240
     LDPAKPEDKA ILDLQRASRF IPTSPDAYKN IEQAAKSAGL IKD                         283
//

If you have problems or comments...

PBIL Back to PBIL home page