(data stored in ACNUC7421 zone)

EMBL: CP000251.PE458

CP000251.PE458       Location/Qualifiers
FT   CDS             complement(543645..544220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80236"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80236.1"
FT                   /translation="MVPLENTATVLLADYRNAPVRYILDTAAGLVTEARAVDPAAAEAG
FT                   ALQRGVVGFGAWQKLHFRQRRRVFMAVYSTGEQLVLRIGTFEVRWPDPELRVRRSAVFA
FT                   HVKRFRVYRADQLILSFLYPFLDWDAFPDNGDILTYAESMTRTPNVTMRTILRFKVIST
FT                   GIDPMSERYVEEVAAALHEADRRTGKEP"
     MVPLENTATV LLADYRNAPV RYILDTAAGL VTEARAVDPA AAEAGALQRG VVGFGAWQKL        60
     HFRQRRRVFM AVYSTGEQLV LRIGTFEVRW PDPELRVRRS AVFAHVKRFR VYRADQLILS       120
     FLYPFLDWDA FPDNGDILTY AESMTRTPNV TMRTILRFKV ISTGIDPMSE RYVEEVAAAL       180
     HEADRRTGKE P                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page