(data stored in ACNUC7421 zone)

EMBL: CP000251.PE459

CP000251.PE459       Location/Qualifiers
FT   CDS             complement(544371..544865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80237"
FT                   /db_xref="GOA:Q2IN57"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80237.1"
FT                   /translation="MRRGEDGLQYIVPTLLIGASYSHLPCASPCRSRSGRGRCTRRMMP
FT                   PPRRRCRRSTKGRDMPNEVTLVQEAGKLVLLGGVVAAIGVAAFRSSVRAFRDPVGTTEA
FT                   RRRNLEARGVPRYTVWVPRDARNWAGMVRWSAAWGAVFGAVLALAGFTGFAVGLYLELM
FT                   R"
     MRRGEDGLQY IVPTLLIGAS YSHLPCASPC RSRSGRGRCT RRMMPPPRRR CRRSTKGRDM        60
     PNEVTLVQEA GKLVLLGGVV AAIGVAAFRS SVRAFRDPVG TTEARRRNLE ARGVPRYTVW       120
     VPRDARNWAG MVRWSAAWGA VFGAVLALAG FTGFAVGLYL ELMR                        164
//

If you have problems or comments...

PBIL Back to PBIL home page