(data stored in ACNUC7421 zone)

EMBL: CP000251.PE47

CP000251.PE47        Location/Qualifiers
FT   CDS             complement(58893..59390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79825"
FT                   /db_xref="InterPro:IPR021383"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79825.1"
FT                   /translation="MNRITLALVAALLAVPAAAADQTASAIKGTGRYGTAGCGLGSMAF
FT                   GNTPGAVQILAATTNGTFGNQTFGITTGTSNCGSGVFTAGTKNFVDANREALAKDISRG
FT                   EGEAIGALTVINACENSHAVGAALQKNFKAIFPSESASNEDVTKAILDTLHGDAALGCG
FT                   RS"
     MNRITLALVA ALLAVPAAAA DQTASAIKGT GRYGTAGCGL GSMAFGNTPG AVQILAATTN        60
     GTFGNQTFGI TTGTSNCGSG VFTAGTKNFV DANREALAKD ISRGEGEAIG ALTVINACEN       120
     SHAVGAALQK NFKAIFPSES ASNEDVTKAI LDTLHGDAAL GCGRS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page