(data stored in ACNUC7421 zone)

EMBL: CP000251.PE472

CP000251.PE472       Location/Qualifiers
FT   CDS             complement(560333..561469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0474"
FT                   /product="Hydrogenase formation HypD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80250"
FT                   /db_xref="GOA:Q2IN68"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80250.1"
FT                   /translation="MSNDDLFRQLKFRDPARARALAEALRHNMDAIGREVSVMHVCGSH
FT                   EQAIARFGLRAVLPPGLELIMGPGCPVCVTDGPEVDEAVALAMQGVRVCTYGDMLRLPG
FT                   TARSLADAQADGGKVEVVYSISQAVELAQAHPEEQVVFLASGFETTAVATAAVALASPP
FT                   PNFSILSVHKYVPAAMEIVAASKETHIEGYVAAGHAAIITGWAIFEPFAARTGAPVVVA
FT                   GFEPLDILAALVKLTELIREGRPEVANVYPRCVTKEGNLPAQRSLWRAFRTVTGRWRGI
FT                   ADVPGGNLELVPELAALDARKRFRIDTAGVRDAAAEEEAKGCICGRIMLGLATPEHCAL
FT                   FGTTCVPESPVGACMVSSEGQCRIWHTYGGVPDLRKVG"
     MSNDDLFRQL KFRDPARARA LAEALRHNMD AIGREVSVMH VCGSHEQAIA RFGLRAVLPP        60
     GLELIMGPGC PVCVTDGPEV DEAVALAMQG VRVCTYGDML RLPGTARSLA DAQADGGKVE       120
     VVYSISQAVE LAQAHPEEQV VFLASGFETT AVATAAVALA SPPPNFSILS VHKYVPAAME       180
     IVAASKETHI EGYVAAGHAA IITGWAIFEP FAARTGAPVV VAGFEPLDIL AALVKLTELI       240
     REGRPEVANV YPRCVTKEGN LPAQRSLWRA FRTVTGRWRG IADVPGGNLE LVPELAALDA       300
     RKRFRIDTAG VRDAAAEEEA KGCICGRIML GLATPEHCAL FGTTCVPESP VGACMVSSEG       360
     QCRIWHTYGG VPDLRKVG                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page