(data stored in ACNUC7421 zone)

EMBL: CP000251.PE474

CP000251.PE474       Location/Qualifiers
FT   CDS             complement(561796..564117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0476"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80252"
FT                   /db_xref="GOA:Q2IN71"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80252.1"
FT                   /translation="MTTQRTTDGGPDRAGEGRRIAVSGTVQGVGFRPFVYRLAHQTGVT
FT                   GRVRNDAAGVTIEAFGPRAALDAFQARLVSDRPPASSIAALRAEPIPAEPAARFEIVES
FT                   GGAAERRVAIPPDLATCPECLRELSDPADRRHRYPFTNCTACGPRFTIALGVPYDRPAT
FT                   TMAGFRMCPACAREYGDPLDRRFHAQPNACPACGPKVSLRDAAGAPLPSADPIRDCAAA
FT                   LRSGGIAAVKGLGGYHLACDASAPAAVRTLRERKRREEKPLAVMVADLDAARALAELSP
FT                   EEAALLAAPERPIVLCRRRPDAALAPELAPGSPIVGLMLAYAPLHHLLLADAGVPLVMT
FT                   SANLSDEPIAFEDEEALARLGGIADLYLVHDRPIASRCDDSVARVVAGRPMVMRRSRGF
FT                   VPRPVRTARRFARPVLAAGAQLKNACCLARGEEATLGPHVGDLDGLETYEAFEAAVARL
FT                   EAFLAFRPELLACDLHPLYLSTRWARERAGALSLPLVEVQHHHAHAAACMAEHGLEGPV
FT                   LALCWDGTGLGADGASWGGELLLAEAARFERLATFRPVALAGGDRAIRDPWRIALAALL
FT                   DAFGDDAPLDRLPLFAGVPARELEVVRRMLAAGLNAPPAHGAGRAFDAAGALALCRPSA
FT                   RFEGQVALALDAAAHGHEAPPYPFDLDASGPVEALDLRPLWRALAADVLAARPAGELSA
FT                   RFHAALAAAGAEQVRRAARRTGRLPVVLTGGCFQNARLAEAIRARLDGEFAVYQHGEVP
FT                   PGDGGIALGQAVVADAVARA"
     MTTQRTTDGG PDRAGEGRRI AVSGTVQGVG FRPFVYRLAH QTGVTGRVRN DAAGVTIEAF        60
     GPRAALDAFQ ARLVSDRPPA SSIAALRAEP IPAEPAARFE IVESGGAAER RVAIPPDLAT       120
     CPECLRELSD PADRRHRYPF TNCTACGPRF TIALGVPYDR PATTMAGFRM CPACAREYGD       180
     PLDRRFHAQP NACPACGPKV SLRDAAGAPL PSADPIRDCA AALRSGGIAA VKGLGGYHLA       240
     CDASAPAAVR TLRERKRREE KPLAVMVADL DAARALAELS PEEAALLAAP ERPIVLCRRR       300
     PDAALAPELA PGSPIVGLML AYAPLHHLLL ADAGVPLVMT SANLSDEPIA FEDEEALARL       360
     GGIADLYLVH DRPIASRCDD SVARVVAGRP MVMRRSRGFV PRPVRTARRF ARPVLAAGAQ       420
     LKNACCLARG EEATLGPHVG DLDGLETYEA FEAAVARLEA FLAFRPELLA CDLHPLYLST       480
     RWARERAGAL SLPLVEVQHH HAHAAACMAE HGLEGPVLAL CWDGTGLGAD GASWGGELLL       540
     AEAARFERLA TFRPVALAGG DRAIRDPWRI ALAALLDAFG DDAPLDRLPL FAGVPARELE       600
     VVRRMLAAGL NAPPAHGAGR AFDAAGALAL CRPSARFEGQ VALALDAAAH GHEAPPYPFD       660
     LDASGPVEAL DLRPLWRALA ADVLAARPAG ELSARFHAAL AAAGAEQVRR AARRTGRLPV       720
     VLTGGCFQNA RLAEAIRARL DGEFAVYQHG EVPPGDGGIA LGQAVVADAV ARA              773
//

If you have problems or comments...

PBIL Back to PBIL home page