(data stored in ACNUC7421 zone)

EMBL: CP000251.PE475

CP000251.PE475       Location/Qualifiers
FT   CDS             complement(564262..564789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0477"
FT                   /product="peptidase M52, hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80253"
FT                   /db_xref="GOA:Q2IN70"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80253.1"
FT                   /translation="MARIAVFGIGNVLTGDDAVGPYVVKVLEARWELPGVEVVDAGTPG
FT                   LDLTAYFAGLDAAILVDAVKARAAPGELRTYSREDLVKRSPVLAVSPHEPGLREAVMNA
FT                   EFMGVCPATVRLVGVVAERTDLGCALSPSVQAAVPAAVEQVLSELRALGVAPRPRDPPV
FT                   EPDLWWEKGRAG"
     MARIAVFGIG NVLTGDDAVG PYVVKVLEAR WELPGVEVVD AGTPGLDLTA YFAGLDAAIL        60
     VDAVKARAAP GELRTYSRED LVKRSPVLAV SPHEPGLREA VMNAEFMGVC PATVRLVGVV       120
     AERTDLGCAL SPSVQAAVPA AVEQVLSELR ALGVAPRPRD PPVEPDLWWE KGRAG            175
//

If you have problems or comments...

PBIL Back to PBIL home page