(data stored in ACNUC7421 zone)

EMBL: CP000251.PE476

CP000251.PE476       Location/Qualifiers
FT   CDS             complement(564883..566616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0478"
FT                   /product="Nickel-dependent hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80254"
FT                   /db_xref="GOA:Q2IN69"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80254.1"
FT                   /translation="MSKLITIDPVTRIEGHLRIDVEVDGGAVKNAWSSGTMWRGIETIL
FT                   QGRDPRDAWIFTQRICGVCTTVHAIASVRSVENALGLEIPLNAQLIRNLIVTAHTLHDH
FT                   IVHFYQLSALDWVDVTSALKADPVKAAQLAESISSWPGNSKHELAAVKARLEGFVKAGQ
FT                   MGIFTNGYWGHPAMKLSPEVNLLAVAHYLQALEIQRKANMAVAILGSKTPNIQNLAVGG
FT                   VANAINLDSPAALNMEKLYQVKTLIDEVATFVQQCYLPDVAAIGGFYPDWFKYGAGVTN
FT                   YLSVPELPLDEKMSKFDIPGGVLWNGKLELAHKLAGWNDDYLKQNVTESIAHAHYDGAW
FT                   AKGPWEEDDKPKFAGEWKHETPAPDRYTWVKAPRLEGKPVQVGPLACVLVGLASGHEPT
FT                   TRWATAAIGAVKAIHKIDLTPAHLHSTLGRHAARAIRAAMMAEMAQKQWKLLVENIGKG
FT                   DTRIWVDPMANLKPGIYKGVGFHEAPRGTLSHWCVIEADKKGMKLKNYQCVVPSTWNAG
FT                   PRDASGTLGPYEKSLVGNPIADPKLPLEALRTIHSFDPCLACAIHTVDAEGDEIARVKV
FT                   L"
     MSKLITIDPV TRIEGHLRID VEVDGGAVKN AWSSGTMWRG IETILQGRDP RDAWIFTQRI        60
     CGVCTTVHAI ASVRSVENAL GLEIPLNAQL IRNLIVTAHT LHDHIVHFYQ LSALDWVDVT       120
     SALKADPVKA AQLAESISSW PGNSKHELAA VKARLEGFVK AGQMGIFTNG YWGHPAMKLS       180
     PEVNLLAVAH YLQALEIQRK ANMAVAILGS KTPNIQNLAV GGVANAINLD SPAALNMEKL       240
     YQVKTLIDEV ATFVQQCYLP DVAAIGGFYP DWFKYGAGVT NYLSVPELPL DEKMSKFDIP       300
     GGVLWNGKLE LAHKLAGWND DYLKQNVTES IAHAHYDGAW AKGPWEEDDK PKFAGEWKHE       360
     TPAPDRYTWV KAPRLEGKPV QVGPLACVLV GLASGHEPTT RWATAAIGAV KAIHKIDLTP       420
     AHLHSTLGRH AARAIRAAMM AEMAQKQWKL LVENIGKGDT RIWVDPMANL KPGIYKGVGF       480
     HEAPRGTLSH WCVIEADKKG MKLKNYQCVV PSTWNAGPRD ASGTLGPYEK SLVGNPIADP       540
     KLPLEALRTI HSFDPCLACA IHTVDAEGDE IARVKVL                                577
//

If you have problems or comments...

PBIL Back to PBIL home page