(data stored in ACNUC7421 zone)

EMBL: CP000251.PE48

CP000251.PE48        Location/Qualifiers
FT   CDS             59616..60419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0048"
FT                   /product="Electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79826"
FT                   /db_xref="GOA:Q2ILZ6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79826.1"
FT                   /translation="MALKIVVTAKRVEDPESKIRVKPDGSGIVTDGVNYKINPFDEIAV
FT                   EEALRLKERHGGEVVVASIGGERSQTEIRAALAMGADRGILVRHDGPLDPVVVSALLAK
FT                   VVEQEKPDLVILGKQSIDDDQNQAGQYLAERLGWPQGTFASKTESLESEAEQKKEPGLV
FT                   LSADGKALTVVREVDGGVETLELGLPAVVTTDLRLNKPRFASLPGIMKAKKKPLQELAA
FT                   ASLGVDLAPQVVVKRLSEPPARKGGVKVADVEELWKKLHDEAKVL"
     MALKIVVTAK RVEDPESKIR VKPDGSGIVT DGVNYKINPF DEIAVEEALR LKERHGGEVV        60
     VASIGGERSQ TEIRAALAMG ADRGILVRHD GPLDPVVVSA LLAKVVEQEK PDLVILGKQS       120
     IDDDQNQAGQ YLAERLGWPQ GTFASKTESL ESEAEQKKEP GLVLSADGKA LTVVREVDGG       180
     VETLELGLPA VVTTDLRLNK PRFASLPGIM KAKKKPLQEL AAASLGVDLA PQVVVKRLSE       240
     PPARKGGVKV ADVEELWKKL HDEAKVL                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page