(data stored in ACNUC7421 zone)

EMBL: CP000251.PE482

CP000251.PE482       Location/Qualifiers
FT   CDS             complement(572788..574896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0484"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80260"
FT                   /db_xref="GOA:Q2IN77"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80260.1"
FT                   /translation="MSLNWKLARLVAALTLLPAPGAAEEPAAEPRTEVLLEEIVVKSRR
FT                   EPRADGLEVREVRETPARDLGEALEQALGVGKVRKAGIASDVVLRGLKRDDVNVLVDGT
FT                   RTHGACPSRMDPPAFHLDWAEVDGVEVRRGPFDVSQPGGLGGVVDVRTRGARPGPGAEV
FT                   NVGAGSFGAAESSAVASYGGGRASLLLGGAFKRSDPYLAGDGRNITEIIPATSTGRYRD
FT                   TSDHQTAYDVRSGWAKVGLVPAEGQQLELAYTRQEADDVLYPYLLMDGIRDDTDRVNAT
FT                   WRAGAIGPLASARAQLYWTRVAHDMDDRDRCSSAADPAACAGGLAEAWSMRTEARTRTL
FT                   GAKLEASLGGGDAALDARLGADLVVRNWDNETIRVRRAMPGQPYVGEASIPDVTQTTGG
FT                   VYAELRRALAPSLRATAGARLDVAESYAGVDRRDFYATWRPGSSPERSRTDLLLAGNVQ
FT                   LDWEAARGLTLFAGYGHGTRLPDPQERYMALAGLMGKPAWVGDPSLRPTRSDELDAGLR
FT                   FTADRLLAKAQVFHAWLADEITLVPLALPGGATAKTYAGVSARRVGGEASARLALPLRL
FT                   YAGAAVAYVWARNETAGTPLAEIPPLRASASLRWDDGRFFAEAEEQWAARQDRVDPALG
FT                   ERPTAAWFITNLRAGAEWRGLKAFVGVRNLLDKTYAEHLSYLRDPFAAGVKVPEPGRTL
FT                   YANVQYAF"
     MSLNWKLARL VAALTLLPAP GAAEEPAAEP RTEVLLEEIV VKSRREPRAD GLEVREVRET        60
     PARDLGEALE QALGVGKVRK AGIASDVVLR GLKRDDVNVL VDGTRTHGAC PSRMDPPAFH       120
     LDWAEVDGVE VRRGPFDVSQ PGGLGGVVDV RTRGARPGPG AEVNVGAGSF GAAESSAVAS       180
     YGGGRASLLL GGAFKRSDPY LAGDGRNITE IIPATSTGRY RDTSDHQTAY DVRSGWAKVG       240
     LVPAEGQQLE LAYTRQEADD VLYPYLLMDG IRDDTDRVNA TWRAGAIGPL ASARAQLYWT       300
     RVAHDMDDRD RCSSAADPAA CAGGLAEAWS MRTEARTRTL GAKLEASLGG GDAALDARLG       360
     ADLVVRNWDN ETIRVRRAMP GQPYVGEASI PDVTQTTGGV YAELRRALAP SLRATAGARL       420
     DVAESYAGVD RRDFYATWRP GSSPERSRTD LLLAGNVQLD WEAARGLTLF AGYGHGTRLP       480
     DPQERYMALA GLMGKPAWVG DPSLRPTRSD ELDAGLRFTA DRLLAKAQVF HAWLADEITL       540
     VPLALPGGAT AKTYAGVSAR RVGGEASARL ALPLRLYAGA AVAYVWARNE TAGTPLAEIP       600
     PLRASASLRW DDGRFFAEAE EQWAARQDRV DPALGERPTA AWFITNLRAG AEWRGLKAFV       660
     GVRNLLDKTY AEHLSYLRDP FAAGVKVPEP GRTLYANVQY AF                          702
//

If you have problems or comments...

PBIL Back to PBIL home page