(data stored in ACNUC7421 zone)

EMBL: CP000251.PE484

CP000251.PE484       Location/Qualifiers
FT   CDS             complement(575598..579899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80262"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80262.1"
FT                   /translation="MTLRLLPALAAASLSLLAARAGAAGAPWEGAPFSADPKAMLAAAQ
FT                   ALAPPRAAGVDVLLEEGRFRYDARGALTLEHRLVFRLLTAEAARSWSRVERSYAPWQQA
FT                   RPELRARVITAQGEVHELDPATLTEQGVADRADLMYSDRRVVAGPLPAVRVGSLVEELI
FT                   VVRDTAPSFDGGTSARFFLAQALPARRIRVEVAAPAELPLRWVVRGTDAAPKETKERGE
FT                   RRLVIDRRDVPGWTAVEPGAPRDTPPAPYLAFGWGRSWADVSARYAASWERQLAGSGLA
FT                   AAAREALGEGQAPDRAEAVRRVVAWVHRNVRYTGLELGEAALVPAAPDEVLKRRYGDCK
FT                   DLSLLVAGMLRAAGHDARLALVRTDWHEVNPELPGISQFDHVVVRVEGSPAIWVDATDP
FT                   YTPPGVLPPAVEGRLALVTPGGRELVRTPERGAADNRVRIVRELFMAESGRGRIRETRE
FT                   LVGALAATERAFRERIPPERRDEVAEHYAKEVLRAAEVLSASTEGLDDPSAPLRLVVDA
FT                   KETDAVRTADDEAELPVTPDQVFDALPGFLTGDPEGHGAAPPAKRTADLLLVVPYQWEV
FT                   TYRIHVPDGFEPRPLPASTTERFGPATYAQTYARAPDGTVTATFRFDTGGRRLSAADAA
FT                   ALGKRAREVVRGSSPVVALDRTAAALLAAGKVPEALGEMRRLAALHPKEALHHVQLAAA
FT                   LVRLGFSEQAATEVRQAIALEPDSAWAHRILGWILQHDAVGRYQGPGHDRAGALAAYRK
FT                   AKDLDPDHAGGRAALAELLAREANGAPAATIGEAVEEFEAIRADLHEQAFDGPYLRTLF
FT                   DAGRDAGAEKLARDMPRGRERDGLLLAAVAMQRGAPAAEEESRGMGDGRRDALRDAARL
FT                   MVGRRSYAAAAALASAAAQGAPNAAEIRQQADLFQGLKPWETLAPQGTEAARLVKRLFV
FT                   AAIRSPAPARELPGMVARDRLGPELVRIADQGLGGPIAGARRTLHEQGIPPDVLLDLVL
FT                   SRVEMLEDGDPRAAVRVRVQFPFTPGDGRSAVFVVREGKEPKVLATDTAWPILGAEALR
FT                   LAGAGDLAGARRWLDWARETLPGAESDPSTPAGVLARLWRPGAEAGAPEVRRAAAAVLA
FT                   WADEAGRSIPTLSEARARATDPAERRALGFALAQAYRAAGKREDQLRVARELLQDDPAS
FT                   REAFALGAVALADLKRPAELEALAAGVLQRLPDDPEVLGLLGNLRLGAGNVDEAAKAFR
FT                   RLIDGGKASPLVLNNAAWLELFRATPGKDALDWARRAVEGERGQNHPSLNTLAAIYAAS
FT                   GQPAEAREVFLRSLDVSGDALEPADWFVFGRIAEAWGVPEAARAAYARVAPDPLDPTAP
FT                   HTLAQRRLALLGPAPAPASPGGAKPAPGDAPAVPPARPLPAAAPAPAAAPPATPAAPAR
FT                   PEGGQPGKKAPARRKPAPPAPKAPAAGARPA"
     MTLRLLPALA AASLSLLAAR AGAAGAPWEG APFSADPKAM LAAAQALAPP RAAGVDVLLE        60
     EGRFRYDARG ALTLEHRLVF RLLTAEAARS WSRVERSYAP WQQARPELRA RVITAQGEVH       120
     ELDPATLTEQ GVADRADLMY SDRRVVAGPL PAVRVGSLVE ELIVVRDTAP SFDGGTSARF       180
     FLAQALPARR IRVEVAAPAE LPLRWVVRGT DAAPKETKER GERRLVIDRR DVPGWTAVEP       240
     GAPRDTPPAP YLAFGWGRSW ADVSARYAAS WERQLAGSGL AAAAREALGE GQAPDRAEAV       300
     RRVVAWVHRN VRYTGLELGE AALVPAAPDE VLKRRYGDCK DLSLLVAGML RAAGHDARLA       360
     LVRTDWHEVN PELPGISQFD HVVVRVEGSP AIWVDATDPY TPPGVLPPAV EGRLALVTPG       420
     GRELVRTPER GAADNRVRIV RELFMAESGR GRIRETRELV GALAATERAF RERIPPERRD       480
     EVAEHYAKEV LRAAEVLSAS TEGLDDPSAP LRLVVDAKET DAVRTADDEA ELPVTPDQVF       540
     DALPGFLTGD PEGHGAAPPA KRTADLLLVV PYQWEVTYRI HVPDGFEPRP LPASTTERFG       600
     PATYAQTYAR APDGTVTATF RFDTGGRRLS AADAAALGKR AREVVRGSSP VVALDRTAAA       660
     LLAAGKVPEA LGEMRRLAAL HPKEALHHVQ LAAALVRLGF SEQAATEVRQ AIALEPDSAW       720
     AHRILGWILQ HDAVGRYQGP GHDRAGALAA YRKAKDLDPD HAGGRAALAE LLAREANGAP       780
     AATIGEAVEE FEAIRADLHE QAFDGPYLRT LFDAGRDAGA EKLARDMPRG RERDGLLLAA       840
     VAMQRGAPAA EEESRGMGDG RRDALRDAAR LMVGRRSYAA AAALASAAAQ GAPNAAEIRQ       900
     QADLFQGLKP WETLAPQGTE AARLVKRLFV AAIRSPAPAR ELPGMVARDR LGPELVRIAD       960
     QGLGGPIAGA RRTLHEQGIP PDVLLDLVLS RVEMLEDGDP RAAVRVRVQF PFTPGDGRSA      1020
     VFVVREGKEP KVLATDTAWP ILGAEALRLA GAGDLAGARR WLDWARETLP GAESDPSTPA      1080
     GVLARLWRPG AEAGAPEVRR AAAAVLAWAD EAGRSIPTLS EARARATDPA ERRALGFALA      1140
     QAYRAAGKRE DQLRVARELL QDDPASREAF ALGAVALADL KRPAELEALA AGVLQRLPDD      1200
     PEVLGLLGNL RLGAGNVDEA AKAFRRLIDG GKASPLVLNN AAWLELFRAT PGKDALDWAR      1260
     RAVEGERGQN HPSLNTLAAI YAASGQPAEA REVFLRSLDV SGDALEPADW FVFGRIAEAW      1320
     GVPEAARAAY ARVAPDPLDP TAPHTLAQRR LALLGPAPAP ASPGGAKPAP GDAPAVPPAR      1380
     PLPAAAPAPA AAPPATPAAP ARPEGGQPGK KAPARRKPAP PAPKAPAAGA RPA             1433
//

If you have problems or comments...

PBIL Back to PBIL home page