(data stored in ACNUC7421 zone)

EMBL: CP000251.PE486

CP000251.PE486       Location/Qualifiers
FT   CDS             complement(580777..581394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0488"
FT                   /product="protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80264"
FT                   /db_xref="GOA:Q2IN81"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80264.1"
FT                   /translation="MTLPRRSGIRALPARGPTMESILGSFLLVAASEMGDKTQLLAFSL
FT                   ATRFRKPWPIMAGILVATLANHGLASSLGAWISANVPARMLAGVLALTFLMFGLWTLRP
FT                   DSLEASKGPERFGAFLTTTVLFFLAEMGDKTQLATVALAARYGDVIRVTAGTTLGMLAA
FT                   DGLAVFLGEKLAARVSSARIRWAAAGLFFLFGLISAWAAIFG"
     MTLPRRSGIR ALPARGPTME SILGSFLLVA ASEMGDKTQL LAFSLATRFR KPWPIMAGIL        60
     VATLANHGLA SSLGAWISAN VPARMLAGVL ALTFLMFGLW TLRPDSLEAS KGPERFGAFL       120
     TTTVLFFLAE MGDKTQLATV ALAARYGDVI RVTAGTTLGM LAADGLAVFL GEKLAARVSS       180
     ARIRWAAAGL FFLFGLISAW AAIFG                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page