(data stored in ACNUC7421 zone)

EMBL: CP000251.PE488

CP000251.PE488       Location/Qualifiers
FT   CDS             583150..583986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80266"
FT                   /db_xref="GOA:Q2IN84"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80266.1"
FT                   /translation="MPSQPIIAQARQGPQAPAAAPAKRRSMLPHEHGAWGQLAMPLLTA
FT                   LAIARPGAAAWLLTAAVVLAFVAHEPLLVVLGQRGRRAVAEDGARARRWLAALGGLAAA
FT                   TGIAGIALAPPVARLALLLPAALAALVGVLVWRRLEKTVAGEITVAAALASAGYAVALA
FT                   AGAEHPAALAALLAWILAFGAATLAVQVILVRVRSKGAADPGRRHAVLAGLLAVAAVAL
FT                   SAAGLPGALALATLPTALFSIVVCLVRVSPKRLRELGWALVGSSAVTLVILVVGLR"
     MPSQPIIAQA RQGPQAPAAA PAKRRSMLPH EHGAWGQLAM PLLTALAIAR PGAAAWLLTA        60
     AVVLAFVAHE PLLVVLGQRG RRAVAEDGAR ARRWLAALGG LAAATGIAGI ALAPPVARLA       120
     LLLPAALAAL VGVLVWRRLE KTVAGEITVA AALASAGYAV ALAAGAEHPA ALAALLAWIL       180
     AFGAATLAVQ VILVRVRSKG AADPGRRHAV LAGLLAVAAV ALSAAGLPGA LALATLPTAL       240
     FSIVVCLVRV SPKRLRELGW ALVGSSAVTL VILVVGLR                               278
//

If you have problems or comments...

PBIL Back to PBIL home page