(data stored in ACNUC7421 zone)

EMBL: CP000251.PE491

CP000251.PE491       Location/Qualifiers
FT   CDS             complement(585413..586201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0493"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80269"
FT                   /db_xref="GOA:Q2IN85"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80269.1"
FT                   /translation="MEFEVDVRRMELRGRPVLRDVRFSVAAGERVVLLGVNGCGKTTLL
FT                   KLMDGLAFPQEGAVRWRGRPLEPAALAGAAFRRAFRGEVGLLFQNVDAMLFNPSVADEI
FT                   AFGPRQLGVPEAEVEARVARWAGAFGLTALQERPPFELSGGEKKRVAMAALMAVGPKVL
FT                   LLDEPTAGLDPASAGRLVDFLAGLEGTTVVTSTHHLTLAEELGTRAVLLGPDRPGVLHD
FT                   GPTGALVRDERALVESGLAHRHVHAHGAEVHAHFHVHDTE"
     MEFEVDVRRM ELRGRPVLRD VRFSVAAGER VVLLGVNGCG KTTLLKLMDG LAFPQEGAVR        60
     WRGRPLEPAA LAGAAFRRAF RGEVGLLFQN VDAMLFNPSV ADEIAFGPRQ LGVPEAEVEA       120
     RVARWAGAFG LTALQERPPF ELSGGEKKRV AMAALMAVGP KVLLLDEPTA GLDPASAGRL       180
     VDFLAGLEGT TVVTSTHHLT LAEELGTRAV LLGPDRPGVL HDGPTGALVR DERALVESGL       240
     AHRHVHAHGA EVHAHFHVHD TE                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page