(data stored in ACNUC7421 zone)

EMBL: CP000251.PE498

CP000251.PE498       Location/Qualifiers
FT   CDS             590065..590853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80276"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80276.1"
FT                   /translation="MRHAGCSGIGSSRMSRRREDTMKRWIIGAAAALLASGAARAQTTP
FT                   TTDPVQQQDRDRLHDGSGAGDQVRQHDRLHDGSGIGDQVREMAKDPAHRADPTAMGDQV
FT                   RQMAQDRDRLNDRTGTGTGDQTHARMHDQVRAEMHEAMMQHAPTGAGHPELPGQAMQGM
FT                   AQRSAAEAREAQATRAAERHALRHQAGQAATQRPEGPQGQHGAGHGAGMNGAGECGEAA
FT                   GAHHLMEMHGGTMGGHGGTGGMDGGSGTGGGMGGGSGGMH"
     MRHAGCSGIG SSRMSRRRED TMKRWIIGAA AALLASGAAR AQTTPTTDPV QQQDRDRLHD        60
     GSGAGDQVRQ HDRLHDGSGI GDQVREMAKD PAHRADPTAM GDQVRQMAQD RDRLNDRTGT       120
     GTGDQTHARM HDQVRAEMHE AMMQHAPTGA GHPELPGQAM QGMAQRSAAE AREAQATRAA       180
     ERHALRHQAG QAATQRPEGP QGQHGAGHGA GMNGAGECGE AAGAHHLMEM HGGTMGGHGG       240
     TGGMDGGSGT GGGMGGGSGG MH                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page