(data stored in ACNUC7421 zone)

EMBL: CP000251.PE499

CP000251.PE499       Location/Qualifiers
FT   CDS             591006..591473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80277"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80277.1"
FT                   /translation="MGDPDARPYAGATLVKLGRPEEALEAFGTGAAAGGDALIAYYRAL
FT                   ACYDARLYLCADAQLAGVGGRSGPRVAGEAARLRAEIARALRGEPSTAAVDFYLARCEA
FT                   LGRERRPAAAAAFCREAEGLAGRRRDGYRRDEARKLLAGLTARADAAEARP"
     MGDPDARPYA GATLVKLGRP EEALEAFGTG AAAGGDALIA YYRALACYDA RLYLCADAQL        60
     AGVGGRSGPR VAGEAARLRA EIARALRGEP STAAVDFYLA RCEALGRERR PAAAAAFCRE       120
     AEGLAGRRRD GYRRDEARKL LAGLTARADA AEARP                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page