(data stored in ACNUC7421 zone)

EMBL: CP000251.PE5

CP000251.PE5         Location/Qualifiers
FT   CDS             6733..7728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0005"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79783"
FT                   /db_xref="GOA:Q2ILV1"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79783.1"
FT                   /translation="MPRAAIVALGTHVPDRVVTNEELTRHMETTDAWIQERTGIQERRW
FT                   VREGTGNSDLALEATKKALDKAGWKPTDIEAIVYASLSPDHMFPGDGCFLNAKLGIPGV
FT                   PAIDIRNQCTGFLYGLSVADAWIRTGMYRRILLVGSEVHSTGLDVTTRGRDVAVIFGDG
FT                   AGAALLEATDDPGRGVLSCHLHADGRFARDLFTDAPGSIYHPRVQPRMLEDASIFPHME
FT                   GQKVFKHAVVRMPEVLKEAFDKNGVGPQDLKVLVPHQANLRIAQMVQRSLGLRDDQVFN
FT                   NIQRYGNTTAASIPLALAEAVEARGVVRGDLVGLCAFGAGFTWASALVRW"
     MPRAAIVALG THVPDRVVTN EELTRHMETT DAWIQERTGI QERRWVREGT GNSDLALEAT        60
     KKALDKAGWK PTDIEAIVYA SLSPDHMFPG DGCFLNAKLG IPGVPAIDIR NQCTGFLYGL       120
     SVADAWIRTG MYRRILLVGS EVHSTGLDVT TRGRDVAVIF GDGAGAALLE ATDDPGRGVL       180
     SCHLHADGRF ARDLFTDAPG SIYHPRVQPR MLEDASIFPH MEGQKVFKHA VVRMPEVLKE       240
     AFDKNGVGPQ DLKVLVPHQA NLRIAQMVQR SLGLRDDQVF NNIQRYGNTT AASIPLALAE       300
     AVEARGVVRG DLVGLCAFGA GFTWASALVR W                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page