(data stored in ACNUC7421 zone)

EMBL: CP000251.PE50

CP000251.PE50        Location/Qualifiers
FT   CDS             61456..62460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0050"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79828"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79828.1"
FT                   /translation="MTEADLEGLGVHRIAIPVPFPQAGGPVNAYLVEDAGGGLLMFDAG
FT                   LGTPEAQAALEAGFARLGRRFDEVTRIVVSHGHVDHYGAARFVQERHGAPDLPVFGHPA
FT                   DAPKMSEQGPRWRELAPRLAAYLARQGVPPEVVELLAKQGEGGFRYARRLPEVRPIAEG
FT                   EVLRTRHLALEVVHMPGHTPGLLCLYEREKRLFFSDDHLLEKVSPNPLVELGPDGQDGF
FT                   FHPLLAYLDSLRRLRALEVDLVLPGHGPPFSGHREIIDALVGFYAKRQARMLELLRAGP
FT                   RTAHEIARALWPHARPADAFLTLSETVANLEVMESRGEVRRDRAAEPWRYLAA"
     MTEADLEGLG VHRIAIPVPF PQAGGPVNAY LVEDAGGGLL MFDAGLGTPE AQAALEAGFA        60
     RLGRRFDEVT RIVVSHGHVD HYGAARFVQE RHGAPDLPVF GHPADAPKMS EQGPRWRELA       120
     PRLAAYLARQ GVPPEVVELL AKQGEGGFRY ARRLPEVRPI AEGEVLRTRH LALEVVHMPG       180
     HTPGLLCLYE REKRLFFSDD HLLEKVSPNP LVELGPDGQD GFFHPLLAYL DSLRRLRALE       240
     VDLVLPGHGP PFSGHREIID ALVGFYAKRQ ARMLELLRAG PRTAHEIARA LWPHARPADA       300
     FLTLSETVAN LEVMESRGEV RRDRAAEPWR YLAA                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page