(data stored in ACNUC7421 zone)

EMBL: CP000251.PE51

CP000251.PE51        Location/Qualifiers
FT   CDS             62515..63276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0051"
FT                   /product="Integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79829"
FT                   /db_xref="GOA:Q2ILZ7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79829.1"
FT                   /translation="MLELLGQADTWISLVTLSAMEIVLGIDNVVFLTILAGRLPQEQQG
FT                   KARKLGLSFALLTRLGLLFAISWVMGLTRPLFEVLGREVSGRDLILLGGGLFLIAKATH
FT                   EIHDKLEVEHAEERKAGGGAAFWAVIVQIALLDIVFSLDSVITAVGMAKHLPVMVAAMI
FT                   LAVGVMLVFADAIGGFVERHPTIKMLALSFLILIGVMLVAEGLGKHIEKGYVYFAMAFS
FT                   LGVELLNMRVRKARQAPVHLHGRFEEERAGR"
     MLELLGQADT WISLVTLSAM EIVLGIDNVV FLTILAGRLP QEQQGKARKL GLSFALLTRL        60
     GLLFAISWVM GLTRPLFEVL GREVSGRDLI LLGGGLFLIA KATHEIHDKL EVEHAEERKA       120
     GGGAAFWAVI VQIALLDIVF SLDSVITAVG MAKHLPVMVA AMILAVGVML VFADAIGGFV       180
     ERHPTIKMLA LSFLILIGVM LVAEGLGKHI EKGYVYFAMA FSLGVELLNM RVRKARQAPV       240
     HLHGRFEEER AGR                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page